2.50 Rating by CuteStat

canadianmunch.com is 5 years 3 months old. It is a domain having com extension. It has a global traffic rank of #5915381 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, canadianmunch.com is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 175
Daily Pageviews: 350

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 5,915,381
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

23.227.38.71

Hosted Country:

Canada CA

Location Latitude:

45.4153

Location Longitude:

-75.6894

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 23.227.38.71)

DNS resolution error | avitdigital.com | Cloudflare

- avitdigital.com
3,485,667 $ 240.00

DNS resolution error | kendama-co.com | Cloudflare

- kendama-co.com
Not Applicable $ 8.95

LifestyleHunt

- lifestylehunt.com
Not Applicable $ 8.95

DNS resolution error | skinnyfoxdetox.com | Cloudflare

- skinnyfoxdetox.com
7,002,385 $ 240.00

ENTER THE DEALS

- enterthedeals.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 403 Forbidden
Server: cloudflare
Date: Sat, 04 Feb 2023 19:06:55 GMT
Content-Type: text/html
Content-Length: 553
Connection: keep-alive
CF-RAY: 7945afb19b789694-SJC

Domain Information

Domain Registrar: TUCOWS, INC.
Registration Date: Feb 8, 2019, 8:37 AM 5 years 3 months 3 days ago
Expiration Date: Feb 8, 2023, 8:37 AM 1 year 3 months 5 days ago
Domain Status:
clienttransferprohibited
clientupdateprohibited

Domain Nameserver Information

Host IP Address Country
ns-cloud-d1.googledomains.com 216.239.32.109 United States of America United States of America
ns-cloud-d2.googledomains.com 216.239.34.109 United States of America United States of America
ns-cloud-d3.googledomains.com 216.239.36.109 United States of America United States of America
ns-cloud-d4.googledomains.com 216.239.38.109 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
canadianmunch.com A 86400 IP: 23.227.38.71
canadianmunch.com NS 21600 Target: ns-cloud-d2.googledomains.com
canadianmunch.com NS 21600 Target: ns-cloud-d1.googledomains.com
canadianmunch.com NS 21600 Target: ns-cloud-d4.googledomains.com
canadianmunch.com NS 21600 Target: ns-cloud-d3.googledomains.com
canadianmunch.com SOA 21600 MNAME: ns-cloud-d1.googledomains.com
RNAME: cloud-dns-hostmaster.google.com
Serial: 1
Refresh: 21600
Retry: 3600
Expire: 259200
Minimum TTL: 300
canadianmunch.com MX 86400 Priority: 1
Target: mx.canadianmunch.com.cust.b.hostedemail.com

Similarly Ranked Websites

intheflowbook.com

- intheflowbook.com
5,915,389 $ 240.00

Apache HTTP Server Test Page powered by CentOS

- mixedproductsmedia.com
5,915,395 $ 240.00

The domain name gigpad.com is for sale

- gigpad.com

Purchase gigpad.com today. Starter logo included. Money back guarantee. Fast domain transfer.

5,915,400 $ 240.00


New Westminster Family Practice

- newwestminsterfamilypractice.ca
5,915,407 $ 240.00

Full WHOIS Lookup

Domain Name: CANADIANMUNCH.COM
Registry Domain ID: 2359047604_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://tucowsdomains.com
Updated Date: 2022-01-26T05:03:07
Creation Date: 2019-02-08T08:37:56
Registrar Registration Expiration Date: 2023-02-08T08:37:56
Registrar: TUCOWS, INC.
Registrar IANA ID: 69
Reseller: Shopify
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID:
Registrant Name: Contact Privacy Inc. Customer 0153906538
Registrant Organization: Contact Privacy Inc. Customer 0153906538
Registrant Street: 96 Mowat Ave
Registrant City: Toronto
Registrant State/Province: ON
Registrant Postal Code: M6K 3M1
Registrant Country: CA
Registrant Phone: +1.4165385457
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: canadianmunch.com@contactprivacy.com
Registry Admin ID:
Admin Name: Contact Privacy Inc. Customer 0153906538
Admin Organization: Contact Privacy Inc. Customer 0153906538
Admin Street: 96 Mowat Ave
Admin City: Toronto
Admin State/Province: ON
Admin Postal Code: M6K 3M1
Admin Country: CA
Admin Phone: +1.4165385457
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: canadianmunch.com@contactprivacy.com
Registry Tech ID:
Tech Name: Contact Privacy Inc. Customer 0153906538
Tech Organization: Contact Privacy Inc. Customer 0153906538
Tech Street: 96 Mowat Ave
Tech City: Toronto
Tech State/Province: ON
Tech Postal Code: M6K 3M1
Tech Country: CA
Tech Phone: +1.4165385457
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: canadianmunch.com@contactprivacy.com
Name Server: ns-cloud-d1.googledomains.com
Name Server: ns-cloud-d2.googledomains.com
Name Server: ns-cloud-d3.googledomains.com
Name Server: ns-cloud-d4.googledomains.com
DNSSEC: unsigned
Registrar Abuse Contact Email: domainabuse@tucows.com
Registrar Abuse Contact Phone: +1.4165350123
URL of the ICANN WHOIS Data Problem Reporting System: https://icann.org/wicf
>>> Last update of WHOIS database: 2023-02-04T19:07:05Z <<<

"For more information on Whois status codes, please visit https://icann.org/epp"

Registration Service Provider:
Shopify
https://help.shopify.com/en/questions#/login


The Data in the Tucows Registrar WHOIS database is provided to you by Tucows
for information purposes only, and may be used to assist you in obtaining
information about or related to a domain name's registration record.

Tucows makes this information available "as is," and does not guarantee its
accuracy.

By submitting a WHOIS query, you agree that you will use this data only for
lawful purposes and that, under no circumstances will you use this data to:
a) allow, enable, or otherwise support the transmission by e-mail,
telephone, or facsimile of mass, unsolicited, commercial advertising or
solicitations to entities other than the data recipient's own existing
customers; or (b) enable high volume, automated, electronic processes that
send queries or data to the systems of any Registry Operator or
ICANN-Accredited registrar, except as reasonably necessary to register
domain names or modify existing registrations.

The compilation, repackaging, dissemination or other use of this Data is
expressly prohibited without the prior written consent of Tucows.

Tucows reserves the right to terminate your access to the Tucows WHOIS
database in its sole discretion, including without limitation, for excessive
querying of the WHOIS database or for failure to otherwise abide by this
policy.

Tucows reserves the right to modify these terms at any time.

By submitting this query, you agree to abide by these terms.

NOTE: THE WHOIS DATABASE IS A CONTACT DATABASE ONLY. LACK OF A DOMAIN
RECORD DOES NOT SIGNIFY DOMAIN AVAILABILITY.